SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037687 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037687
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1e-55
Family DnaQ-like 3'-5' exonuclease 0.0000000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037687   Gene: ENSMODG00000025322   Transcript: ENSMODT00000039289
Sequence length 241
Comment pep:novel chromosome:BROADO5:X:24730885:24731610:-1 gene:ENSMODG00000025322 transcript:ENSMODT00000039289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELPTCETFVFLDLEATGLPNAHPEIAEISLFAIHRFSLEHPERDESGTLQLPRVLDKL
TLCMCPEQNFTPKASEITGLSNQNLADNHKAGFNGAVIRALREFLKRQKSPICLVAHNGF
DYDFPLLRTELQRLGADLPGGTVCLDTLPALRGLDKVHHHSTRASHGKKSYSLGNLYRRY
FDDEPQAAHSAEGDVYALVMVFLHRAQELLQCVQTEAQNWDEIQPMYTPRKRRLSGGSLD
A
Download sequence
Identical sequences F7E760
ENSMODP00000037687 XP_007507152.1.35504 XP_007507153.1.35504 XP_007507154.1.35504 XP_007507155.1.35504 13616.ENSMODP00000037687 ENSMODP00000037687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]