SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037814 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037814
Domain Number 1 Region: 189-374
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.06e-50
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 9-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.21e-46
Family Canonical RBD 0.0000499
Further Details:      
 
Domain Number 3 Region: 493-627
Classification Level Classification E-value
Superfamily PABC (PABP) domain 4.06e-37
Family PABC (PABP) domain 0.0000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037814   Gene: ENSMODG00000015024   Transcript: ENSMODT00000019124
Sequence length 635
Comment pep:novel chromosome:BROADO5:X:15040216:15042123:-1 gene:ENSMODG00000015024 transcript:ENSMODT00000019124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGHSTPNSPTASLYVGDLHHDVTESMLYEKFSPAGPILSIRVCRDSVTQHSLGYAYVNFQ
HRAHAEWVLATMNLDVIKGNPIRIMWSQRDPGQRKRGVGNVFVKNLEKSIDNKALYDTFS
TFGRILSCKVISDENGSKGYGFVHFETQESAGKAIEKMNGMLLNNLKVFVGRFKSRRERE
SELGVKAKDYTNIYIKNFGENMDDQRLTEIFAKYGPTLSVKVMTDDCGRSKGFGFVSFQS
HEDAQAAVDDMNGKQLNGKQIYVGRAQKKRERQTELKRHFEQIKQNQHIRYQGVNLYIKN
LDDTINDEHLRKEFSPFGTITSAKVMMENGRSKGFGFVCFSSSKDAAKASREMNGKLVAS
KPLYVSLAQRKEERRMHLKNQYMYRLAHLRSISNPVFNPYQLANSSPYFMTPSLPSQSQA
ALYNASQLAQLRSSPRWISKSIRPPSFHTLTKAICPNIPRATFSPLRSTSEIPRMGATSR
VANSPAQMLGPLPGTGTFLPTVPNVPHLKYDAGVDYPEQPFSKSPYISTLARQPAGHISG
QESLMPSMLASALPPEQKRILGERLFPIIQGISPTLAGKITGMLLETDNSEILHLLESPE
SLHCKVKEAAAVLQTHQAKEVTQKEVNGATGGAPT
Download sequence
Identical sequences F7E640
13616.ENSMODP00000037814 ENSMODP00000037814 ENSMODP00000037814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]