SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037910 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037910
Domain Number 1 Region: 544-832
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-49
Family Tandem AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 68-222
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.04e-31
Family DnaQ-like 3'-5' exonuclease 0.016
Further Details:      
 
Domain Number 3 Region: 908-1034
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.49e-28
Family RecQ helicase DNA-binding domain-like 0.0000135
Further Details:      
 
Domain Number 4 Region: 1059-1141
Classification Level Classification E-value
Superfamily HRDC-like 1.48e-17
Family HRDC domain from helicases 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000037910
Domain Number - Region: 1153-1200
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0222
Family Sigma4 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037910   Gene: ENSMODG00000018997   Transcript: ENSMODT00000039513
Sequence length 1333
Comment pep:known_by_projection chromosome:BROADO5:5:13423096:13562938:-1 gene:ENSMODG00000018997 transcript:ENSMODT00000039513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENEVSKTLQARKLPEWMSALQKEPDPEKKKRSLLEDNLPLLKFPGSIVYSYEANDCSF
LAEDIRMSLSDGAVIGFDMEWPPPFWKGRPGRVALIQLCVSESKCYLFHIASMSVFPRGL
KMLLESETIRKAGLGTGDQWKLLRDFDVHLRSFVELASLANEKLRCKENWSLDGLVKHLF
RKCLLKEQSIRCGRWEDFPLTEDQKQYAAIDAYASFIIHQQLETLSGTDQMLPTKATEDQ
FPEKVKKQLLSLSEEMVDLTKRFSHPRRPSREPQRVMELLKSLSEDLDTLRTTLLGVPSP
ERHLGAHSGSPAPSEAPSVPGEGAQAASKHSGWDSKSGNLLGPGGGNRMDSAVELTAARY
EGRREDQGPQEDERRVCLMSLDVTEYELQMWEQQEQEERNKATYVSDQDLISAVDTHDLS
SVIESDEDLEMEMLQTLEEVDCDKLEQSVSESPETESEVRTDMADEGDEEAIEEEDDEWD
PLLPAPTAEHVICLKTYFGHSSFKPVQWKVIHSVLQERRDNLVVMATGYGKSLCFQFPPV
FVGGIGIVVSPLISLMEDQVLQLEMSNIKACFLGSAQSENVISRVKAGEFRVVYMTPEFC
LVSLDLLKQLDATLGITLVAVDEAHCVSEWGHDFRNAFRNLGLLKTTLPSVPMLALTATA
SSSIRADIAHCLYLRDPQVTCTSFDRPNLYLDVGPKTGSILRDLDKFLVKKPGSCWEFEG
PTIIYCPSRKISEQVTVELRKLDLACGTYHAGMGIKSRREIHHKFMRDEIQCVIATVAFG
MGINKADIRKVIHYGAPKEMESYYQEIGRAGRDGLPSACHVLWTPADINFNRLLLSDIQN
DNFRQYKLKMMRQLEKYLQSSNCRRKIILSHFEDKQLRKASLGIMGTEQCCDNCRARLNN
PHSGDDSEENLKDFGPQAYKLLSAVCVLGQKFGIGMPVLFLRGSNSQRLPDKFRRHCLFG
GGKDHLESWWKALARQLILEGFLEEMPGYNKFAKFCVLSEKGRNWLDQATDESARTLLLH
ANEDLCPRKLLNLSVLPTSPVKPLPAPLNSPASVSSKEQELQTMLYCKLVEERQKQASEK
DIPPALLATNKVLVDMAKMRPSTLESLKNIDGVSEAKCTMLSPLLEVICKFSQMNNLLTD
LFSSPSPGLEEKKRCLSQLPASVSITYSLFQEKNLSLRSIAESRTMPLPVVGTHLSQAVK
AGYPVDLERAGLTPHIQKIITDVIQKPPISSDISKMKAIRTLVPSDIETYLIQIVVALVE
KERKQNVALSDPFPKESNVESGVPSTSGPCSSTNKPSAETSKRKFPEWFSSAKGCAPPPG
SSKKTKARKGLFT
Download sequence
Identical sequences F7AMX7
ENSMODP00000037910 XP_007495631.1.35504 ENSMODP00000037910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]