SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038176 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038176
Domain Number 1 Region: 713-1121
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-43
Family Hermes transposase-like 0.01
Further Details:      
 
Domain Number 2 Region: 458-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000393
Family BED zinc finger 0.021
Further Details:      
 
Domain Number 3 Region: 286-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000666
Family BED zinc finger 0.072
Further Details:      
 
Domain Number 4 Region: 116-171
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000112
Family BED zinc finger 0.089
Further Details:      
 
Domain Number 5 Region: 560-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000714
Family Classic zinc finger, C2H2 0.078
Further Details:      
 
Domain Number 6 Region: 654-713
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0000000222
Family Hermes dimerisation domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038176   Gene: ENSMODG00000025433   Transcript: ENSMODT00000039776
Sequence length 1123
Comment pep:known_by_projection chromosome:BROADO5:8:7391581:7488769:1 gene:ENSMODG00000025433 transcript:ENSMODT00000039776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKNQETCSKMDNSFVLDKINFKVEPEDNTTNHSVERMDFKSEQEDVRQTDSSDEQAEFK
GKTCSGRHPGKCSSADHEEDYGTLFSQYGSTLYDVAMEAVAQSLLSSRNISSRKKSPAWN
HFFISPRDSTKAICMYCMKEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSMPSISSF
PSPSLLLPPQPADVSDLSTVLSPIKLVKKMASKIPSPDRGIEESGSVVSSEEMSSDLSIS
EKYNKEEALVVSSPHLPSAQYDEVVENVAEKTVPVPKSTSGSRRRSAVWKHFYLSPLDNS
KAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRSIVLQENGGGTSIPPLYSAPPTLLPS
LLPSEGDLNSVSSSPGKLVKESPSASSSPDRLTEEIHAHLNPGDALMEDVSVLSSSDDIG
EASLVSSPEKQGDGLSTLIFEPGTVFQQNKKIMKRLKSEVWHHFSLSPTDNLKAVCRYCS
CMISRGKKGDVGTSCLMRHLYRRHPEVIGNQKSFIDASLANSPYATLASAECSSSKLTDL
PTMVSNDNQVIFPVSSKKTSKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLL
RHLQRFHSNVLKNDASETVLPSTAEIRVPLSTELLASSSFDETNEKFCDSHPVAKKITSL
VAEMIALDLQPYSFVDNIGFNRLLEYLQPQYSLPSPSYFSRTAIPDMYDNVKQIIVSHLK
EAESGVIHFTSGIWMSSQTREYLTLTAHWVTFESSVRPHCEDYHCSALLNVSQVDCDYSG
VSVQKQLEYWWEAWVTSVGLQIGITVTDNQSIGKTLNEGEHSSVPCFGHTINLIVNEAIK
SQRMVQNLLSIARKICERVHRSAKAKEKLAELQKEYELPQHHLIQDVPSKWSTSFHMLER
LIEQKRAIDEMSIECSFREQISCDQWEVMQSVCHALKPFEAASREMSTHVSTLSQVIPMI
HILNRKIEMLFEETMGIDTMLKSLKEAMVSRLSSTLHDPRYIFATLLDPRYKASLFTEEE
AEQYKQDLIRELEILSSTSDDKPVSNGCDIGSPSTNSVAEDSLWSLMAKLKKKDLKDKTK
LPEEMVLAYLEEEVLEHNCDPLTYWNLKRSAWPVLAKLAVRDL
Download sequence
Identical sequences F6VLV3
ENSMODP00000038176 ENSMODP00000038176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]