SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038180 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038180
Domain Number 1 Region: 383-635
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-72
Family Protein kinases, catalytic subunit 0.000000000765
Further Details:      
 
Domain Number 2 Region: 12-138
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-30
Family SH2 domain 0.000000241
Further Details:      
 
Domain Number 3 Region: 149-240
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-22
Family SH2 domain 0.00000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038180   Gene: ENSMODG00000019263   Transcript: ENSMODT00000039780
Sequence length 643
Comment pep:known_by_projection chromosome:BROADO5:3:1095502:1201575:-1 gene:ENSMODG00000019263 transcript:ENSMODT00000039780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMATCLADSANHLPFFFGNITREEAEDYLVQGGMGDGLYLLRQSRNYLGGFALSVAFGR
KAHHYTIERELNGTYAITGGRTHVSPAELCIYHSQESDGLVCLLKKPFNRPPGVEPKTGP
FEDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRLESE
QIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQ
VGRKGSQASPGGWGTRVGSRLTLRCQMVPAALNGSGTSSVGQLSWLDLGSLGQRLSSPSV
GLPGQRKEGGSHPSNVNRADSSVELNPYVLQRTDGTSLGADLDMQREALPMDTEVYESPY
ADPEEIRPKEVRLDRTLLTLEEGELGSGNFGTVKRGRYRMKKGDKLVAVKILKNEANDPA
MKDELLREANVMQRLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQKNRHVKDKNII
ELVHQVSMGMKYLEENNFVHRDLAARNVLLVTQHYAKISDFGLSKALNADENYYKAQTHG
KWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGSEVSAMLEKGERME
CPPGCPSEIYDLMKLCWTYEVENRPAFSAVELRLRNYYYDVVN
Download sequence
Identical sequences F6VLR6
ENSMODP00000038180 ENSMODP00000038180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]