SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038186 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038186
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.27e-34
Family Smg-4/UPF3 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038186   Gene: ENSMODG00000010232   Transcript: ENSMODT00000039786
Sequence length 428
Comment pep:known_by_projection chromosome:BROADO5:X:28218523:28237558:-1 gene:ENSMODG00000010232 transcript:ENSMODT00000039786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSKVIIRRLPPTLTKEQLEEHLQPLPEHDYFEFFANDSSLYPHMFSRAYINFKNQEDIV
LFRDRFDGYVFVDHKGQEYPAIVEFAPFQKSAKKKNKKKDAKTGTIEDDPEYKKFLESYC
AEEEKLTSTPETLLEEIEARNKELIAKKTTPLLNFLKNKQRMREEKREERRRREIERKRQ
REEERRKWKEEERRKRKDTDKIKKIERGPEKERDRSKDEPKIKLLKKPERGDEKELEKRE
KSKRLDKEILNEEKPSGQSSTAVKRSDGETKEEKAKKSEDEGGKDHRERDKDYERDKERE
RQQRDKEKLRRQEEDRRRQKERFEKEKTFRRKEEEMKKERDLLRDKGKRNDGTDLIGNSD
RMTREERKEDVSKRDRIRNKDRPAMQLYQPGARSRNRLGPYEDSSLKSAEPAPDKKQENE
NNSRKEEE
Download sequence
Identical sequences F6VLL7
ENSMODP00000038186 ENSMODP00000038186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]