SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038237 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038237
Domain Number 1 Region: 24-113
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-23
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038237   Gene: ENSMODG00000025461   Transcript: ENSMODT00000039837
Sequence length 113
Comment pep:novel chromosome:BROADO5:8:205045741:205046204:1 gene:ENSMODG00000025461 transcript:ENSMODT00000039837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTRVFFCIMMCFLIAGVQPDAGVTQRPSYLVSRKGQSVALGCDPISGHNGAFWYSQIQG
QGPKMLFYYYYKQLNEKGNISDRFVAKQHENNHFTLNINYLELGDSANYLCAS
Download sequence
Identical sequences F6RK33
ENSMODP00000038237 13616.ENSMODP00000038237 ENSMODP00000038237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]