SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038250 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038250
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 190-226
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0765
Family C-terminal domain of RNA polymerase alpha subunit 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038250   Gene: ENSMODG00000025473   Transcript: ENSMODT00000039850
Sequence length 310
Comment pep:known_by_projection chromosome:BROADO5:8:300505052:300519263:-1 gene:ENSMODG00000025473 transcript:ENSMODT00000039850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTICHFFLQGRCRFGERCWNEHPRGGGGSGGGGGGGGGRSPAQPQYAAAPSGCSRGGWSN
SSQRYTNVIQPSNFSKSATWGGSRDPGKTFFGSFDSGASSSGSRNLGFSQTRFSALNPNQ
VDGQKDDDDKLIEGIVKDMEVWESSGQWMFSVYSPMKEKPNISGFTDISPEELRLEYSNH
ITSKNLQSYLNSIQQLVNLWKNRLLELRNINTATKGAVLSKLKNEGNQVVPTFGFHNQQT
STFGSSGFPVNTSTSSGAQNFSFKPTSGFSAAPSGSSTSVFGAQGMPAAPALTVCIHFAK
EKSLNRLAAS
Download sequence
Identical sequences F6QZS2
ENSMODP00000038250 ENSMODP00000038250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]