SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038284 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000038284
Domain Number - Region: 9-40
Classification Level Classification E-value
Superfamily UBA-like 0.00714
Family TAP-C domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038284   Gene: ENSMODG00000025498   Transcript: ENSMODT00000039884
Sequence length 170
Comment pep:known_by_projection chromosome:BROADO5:6:119857123:119883012:1 gene:ENSMODG00000025498 transcript:ENSMODT00000039884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELKHQVMINQFVLTAGCAADQAKQLLQAAHWQFEPLLLKNLTCLRLPSCLNEQN
LMCTPANTPATPPNFPDALTMLSRLKASESFHSSSPMASSATSPPPLPHPPHFGSFPAAS
PPPGPPPQPQQPQHYSWTPAPSSQPSDWPPPASQRATSEQKASATMEAER
Download sequence
Identical sequences F6QYF4
ENSMODP00000038284 ENSMODP00000038284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]