SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038322 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038322
Domain Number 1 Region: 298-405
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-22
Family SH2 domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038322   Gene: ENSMODG00000025533   Transcript: ENSMODT00000039922
Sequence length 419
Comment pep:known_by_projection chromosome:BROADO5:5:219771059:219893853:1 gene:ENSMODG00000025533 transcript:ENSMODT00000039922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGNRKTTKEGSTLLKSQNLGLSPNRSWPHIGAAAGQHRTISENCSSYDKSIVKVADGAKD
SDGEDYEDPKTLPIGAFRSTKILPARPIEESQYADIRCFQEKMNSHISTDTKNNVSMKQQ
PWNFQMRLEKGVQILADVRDLNHKGESEIKGIKNPLPPPRPPNTLPKKYRPLPPEPENRL
TLNQRNDLLEADKSTRQISLKDLSDVINSNDNTRNISRLTHKLDLSEAVLNKVINLTASS
ESSKSNGKTKVRMRHKVSMSSPSLQKASQPAHGNLLDDKPLPTSLLQKKPYHGKCSKKAF
KTYDWYIGEFSRQEVEKALMKENTDGTFLVRDSSKKSMAEPYVLVVFHRNKVYNVKIRFL
EGSQQFALGTGLRGDDKFDSVEDIIEYYKLFPIVLIDGKDQTGTHREHCYLKKPLSLSR
Download sequence
Identical sequences F6V1I2
ENSMODP00000038322 13616.ENSMODP00000038322 ENSMODP00000038322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]