SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038500 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038500
Domain Number 1 Region: 59-83
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000798
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number 2 Region: 34-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038500
Domain Number - Region: 114-140
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number - Region: 140-161
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00157
Family CCCH zinc finger 0.0041
Further Details:      
 
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0183
Family CCCH zinc finger 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038500   Gene: ENSMODG00000025672   Transcript: ENSMODT00000040100
Sequence length 162
Comment pep:known_by_projection chromosome:BROADO5:2:217322004:217334131:1 gene:ENSMODG00000025672 transcript:ENSMODT00000040100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAGLEKMTFNLEEDVENQRGVGYLPFPGMDKSGVAVCTFFLKGFCEKGQLCPFRHDDGEK
TVVCKHWLRGLCKKSDHCKFLHQYDITKMPECYFYSKFGECSNKECLFLHADPAFKIRDC
PWYDQGFCKYGLLCKFRHTRRVLCTNYLVGFCPEGPDCKFTQ
Download sequence
Identical sequences F6U107
ENSMODP00000038500 13616.ENSMODP00000038500 ENSMODP00000038500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]