SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038517 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038517
Domain Number 1 Region: 27-183
Classification Level Classification E-value
Superfamily PR-1-like 1.57e-57
Family PR-1-like 0.00000259
Further Details:      
 
Domain Number 2 Region: 185-240
Classification Level Classification E-value
Superfamily Crisp domain-like 0.00000000000000324
Family Crisp domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038517   Gene: ENSMODG00000025686   Transcript: ENSMODT00000040117
Sequence length 240
Comment pep:novel chromosome:BROADO5:2:296746153:296780936:-1 gene:ENSMODG00000025686 transcript:ENSMODT00000040117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQPVLLCLITLLFSSSVGSQSPTFESLSTKNEAIQEEIVNKHNDLRSNVSPPAKNMLK
MKWSPEAQESAQSWANKCTLEHSLVKNRTIGSPCGENLFMSTVPMHWSKAIQAWHDEVSN
FEYGKGPIDPNQPVGHYTQVVWHSSFKVGCGVAYCPDATYPYFFVCQYCPSGNYGTKYPY
EKGASCDKCPHSCTNNLCNNPCLYTNKFGNCEEMKNKVSCRNKYVKSNCKATCLCVNEIY
Download sequence
Identical sequences F6U003
13616.ENSMODP00000038517 ENSMODP00000038517 ENSMODP00000038517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]