SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038685 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038685
Domain Number 1 Region: 183-330
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-38
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000121
Family Ribonuclease H 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038685   Gene: ENSMODG00000027517   Transcript: ENSMODT00000041793
Sequence length 351
Comment pep:novel chromosome:BROADO5:1:414024383:414025527:-1 gene:ENSMODG00000027517 transcript:ENSMODT00000041793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLQRGFLTSAGKSIANAEIINEVLSALQLPEALAVVHCSAHTGGTDPVSRGNDRADAA
AKLAAIEGPELLLTLTTTDDSNLSLSYDEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRS
FYHQICQSVHNNGHFGTQGIVDSVKRVWIAPGITTIASKVCSACPTCQAYNQHAFRGKAF
GGRPLAYTPFEHLQIDFITMPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKE
IIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMI
GKLCTETHLKWPEILPLALFYLRSRPRGDLHIFHFVLFSFWINSHTPTTKT
Download sequence
Identical sequences K7DYT4
ENSMODP00000038685 ENSMODP00000038685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]