SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038722 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038722
Domain Number 1 Region: 80-302
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.42e-21
Family RNA-dependent RNA-polymerase 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038722
Domain Number - Region: 23-78
Classification Level Classification E-value
Superfamily STIV B116-like 0.0301
Family STIV B116-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038722   Gene: ENSMODG00000027519   Transcript: ENSMODT00000041830
Sequence length 305
Comment pep:novel chromosome:BROADO5:5:253249927:253251003:1 gene:ENSMODG00000027519 transcript:ENSMODT00000041830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKKLESDQIKNPQQKTKLEILKIKGEINKIESDRTIDLINKTRSWYFEKTNKIDKVLV
NLIKKRKEEKQIHSIKDEKGDSTSNEEEIKAIIRNYFAQLYGNKYTNLGEMDEYIQKYKL
PRLTEEEIEFLNNPISEIEIHQAIKELPKKKSPGPDGFTCEFYQTFREQLTPILYKLFDI
ISKEGVLPNSFYDTNMVLIPKPDRSKTEKENYRPISLMNIDAKILNRILAKRLQQVIRRI
IHHDQVGFIPGMQGWFNIRKTIHIIDHINKQTSKNHMIISIDAEKAFDKIQHPFLLKTLE
SIGIE
Download sequence
Identical sequences K7DYX1
ENSMODP00000038722 ENSMODP00000038722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]