SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038788 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038788
Domain Number 1 Region: 278-437
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 18-160
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.71e-27
Family Ribonuclease H 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038788   Gene: ENSMODG00000027506   Transcript: ENSMODT00000041895
Sequence length 472
Comment pep:novel chromosome:BROADO5:4:75468257:75469768:1 gene:ENSMODG00000027506 transcript:ENSMODT00000041895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQG
AELIALKHACIIAKDKKATIYMDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEV
LSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTTTDNLNLSL
SYNEKEVEKWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHNNGHFGTQGIVDSVK
RVWIAPGITTIASKVCSSCSTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDFITMPKAGQ
YKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGSHFTDSVLN
QIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPLALFYLRSR
PRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDTTIASYIQELQQQLREL
Download sequence
Identical sequences K7DZ37
ENSMODP00000038788 ENSMODP00000038788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]