SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038791 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038791
Domain Number 1 Region: 172-255
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000204
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038791   Gene: ENSMODG00000029175   Transcript: ENSMODT00000041898
Sequence length 904
Comment pep:novel chromosome:BROADO5:X:27809299:27825930:-1 gene:ENSMODG00000029175 transcript:ENSMODT00000041898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSIVYDNSEAMELCAAQHLYLKPIARLTINVMLPEDLTYTRSFSNWEVLDQLKNLICP
DQFSTVRLSKSTKDFIRFEGEAETRSLVQILKAKLHGKIIRMNGLKNGLKIVATDAWLDF
PSQQEWELASKKNKAASDELIKQNLNESPDSIYFQGLPCKWFASKGSNGEKPCEEILRVV
FESFGKIKNIDIPMLDPYQEVMATGSFNHCTLGSLQTFEAFIQYQEYADFVKAMESLRGM
KLMLKGEDGKALACNIKVMFDTTQHFSEGAIRKRNQERLKLQELEEERKREKKREEAERK
RKDEEKKLREKKRKTKVKRKEQKQKPKEEKRPKKKAKAEESEKLNSQEMESPKAEEDSIA
EFEVKVLKKEEPAPPNFMIQEAKKKMFKKKPVKHERTPVPQSKRRNELLDSSCHSEKTFV
DDPTKGEFTDQLMPDTCEHSFVSHVNSLQITIKQDLSQAFEDDEEEEDEEDEDDEDDWYA
WNPSSNRKAGYGRKQKIYETDEFIHYLLNYYHPPQYARIYEDLNSAPGKSRWRREVHDDG
NGFQVNLNQSRHHSTRGNIQNGQEIDWAPEDDLLECEDDYQWKLAHQELEPKLREAINAS
CAEEFAKTVKRRCVDSSSEAVGLMLDLGGKQCLWQNSHIGPIKDSKHRGKRKSSSQSKLA
GFSYEVTDFLEEISSDSDCFNETLSEESEHQSPFPNVDRLVKVREDSDNYDETIAFDQEK
KCSQCGMFPLLKPSGLTKPLRTKLKKAVKRSRNELKCPEPKGECETNGVEKNTRKKKKKP
PVEDRLDKDDCPIPDPSSLRALKKPEKKRSKLTESKMKCKASCVPVASSQSVEEALPVQG
LSVNVGNPWKPKSTQETGASNRCVQWKDEPQDSSDCLTSSNSPDPLASENGFEKRSAVFK
LQSF
Download sequence
Identical sequences K7DZ40
ENSMODP00000038791 XP_007507185.1.35504 XP_007507186.1.35504 XP_007507187.1.35504 ENSMODP00000038791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]