SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038806 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038806
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.19e-26
Family Ribonuclease H 0.0033
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.2e-18
Family Reverse transcriptase 0.0000469
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038806
Domain Number - Region: 430-463
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0759
Family Retroviral integrase, catalytic domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038806   Gene: ENSMODG00000028077   Transcript: ENSMODT00000041913
Sequence length 463
Comment pep:novel chromosome:BROADO5:4:204285989:204287554:-1 gene:ENSMODG00000028077 transcript:ENSMODT00000041913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENIT
LKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYMDSRYAFG
ICHSVAMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGK
PLLPRSFYNQICQSVHKNGHFGTQGIVDSVKRVWIAPGITTIASKVCSSCPTCQAYNQHA
FRGKAFGGHPLAYTPFEHLQIDFITMPKAGQYKFCLVIVDQLT
Download sequence
Identical sequences K7DZ55
ENSMODP00000038806 ENSMODP00000038806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]