SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038827 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038827
Domain Number 1 Region: 183-342
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000167
Family Ribonuclease H 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038827   Gene: ENSMODG00000028624   Transcript: ENSMODT00000041934
Sequence length 454
Comment pep:novel chromosome:BROADO5:3:231581019:231582996:1 gene:ENSMODG00000028624 transcript:ENSMODT00000041934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAA
AKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGKPLLPRS
FYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGKAF
GGRPLAYTPFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKE
IIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMI
GKLCTETHLKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGD
ITIASYIQELQHKLRELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKRTGATQPSWEGP
FQILLTTPTSIKIGERDSWIHCSHVKKASSAETD
Download sequence
Identical sequences K7DZ76
ENSMODP00000038827 ENSMODP00000038827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]