SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038871 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038871
Domain Number 1 Region: 90-515
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.67e-116
Family Reverse transcriptase 0.0000000115
Further Details:      
 
Domain Number 2 Region: 829-988
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-39
Family Retroviral integrase, catalytic domain 0.0017
Further Details:      
 
Domain Number 3 Region: 569-711
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-26
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 4 Region: 9-41
Classification Level Classification E-value
Superfamily Acid proteases 0.0000788
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038871   Gene: ENSMODG00000029722   Transcript: ENSMODT00000041977
Sequence length 1100
Comment pep:novel chromosome:BROADO5:2:317266820:317270719:1 gene:ENSMODG00000029722 transcript:ENSMODT00000041977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSLSLEVPEESLNLLPVLL
SENQEAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTKSSPPPSIPQYPLSKEA
IEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIYRFVQDLRAVNNHVIKR
HSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFAFTWKGSQYTWCRLPQG
YVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQEDSKHLLLELHKRGHK
ISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTKKQLRAILGATGFCRQW
IPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAPALGIPDYNKPFTLYVH
ERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLRGVAATALLVKKTVDLVLGCP
LTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSG
EPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWS
ASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGK
SIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILT
LTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGKPLLPRSFYNQICQSIHKNGH
FGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYRGKAFGGRPLAYTPFEHLQ
IDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLPARIDSD
RGSHFTDSVLNQIYSCLGITPKFHVPYHSQSSGQVERMNKELKTMIGKLCTETHLKWPEI
LPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKL
RELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKRTGATEPSWEGPFQILLTTPTSIKIG
ERDSWIHCSHVKKASSAETD
Download sequence
Identical sequences K7DZC0
ENSMODP00000038871 ENSMODP00000038871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]