SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038880 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038880
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.82e-26
Family Ribonuclease H 0.0035
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-18
Family Reverse transcriptase 0.000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038880   Gene: ENSMODG00000029718   Transcript: ENSMODT00000041986
Sequence length 428
Comment pep:novel chromosome:BROADO5:3:201235738:201237509:1 gene:ENSMODG00000029718 transcript:ENSMODT00000041986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQCPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLIKHRTQAFSDQRITRYEITLLNSENIT
LKCCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTDGSSFM
RVGIRYTGAAVVSEFATEWSASLPSNISTQGAELIALKQACIIAKDKKATIYTDSRYAFG
ICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DQADAAAKLAAIEGPGLILTLITTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSSEGK
PLLPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHA
YRGKAFGG
Download sequence
Identical sequences K7DZC9
ENSMODP00000038880 ENSMODP00000038880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]