SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038918 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038918
Domain Number 1 Region: 108-211
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-28
Family Canonical RBD 0.00067
Further Details:      
 
Domain Number 2 Region: 8-110
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-26
Family Canonical RBD 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038918   Gene: ENSMODG00000005157   Transcript: ENSMODT00000042024
Sequence length 375
Comment pep:known_by_projection chromosome:BROADO5:3:456440098:456485176:-1 gene:ENSMODG00000005157 transcript:ENSMODT00000042024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD
PNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNNKSNKIFVGGI
PHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMG
KKVEVKRAEPRDSKSQVPGQPGASQWGSRLMPNAANGWAGQPPPTWQQGYGPQGMWVPAG
QAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGTPPQFSFGYGPPPPP
PDQFAPPGVPPPPATPGAAPLAFPPPPSQAAQDMSKPPAAQPDFPYSQYGLGTYSQDPSG
FGPILCLHSYGQAEQ
Download sequence
Identical sequences K7DZG7
XP_016287724.1.35504 XP_016287725.1.35504 XP_020864524.1.61212 XP_020864525.1.61212 ENSMODP00000038918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]