SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038980 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038980
Domain Number 1 Region: 164-586
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.89e-115
Family Reverse transcriptase 0.0000000643
Further Details:      
 
Domain Number 2 Region: 642-788
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-29
Family Ribonuclease H 0.0018
Further Details:      
 
Domain Number 3 Region: 22-115
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000938
Family Retroviral protease (retropepsin) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038980   Gene: ENSMODG00000028504   Transcript: ENSMODT00000042089
Sequence length 904
Comment pep:novel chromosome:BROADO5:8:34887962:34890676:-1 gene:ENSMODG00000028504 transcript:ENSMODT00000042089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLRGYQGGFHSGVRSPVGITHIVIVSHPIEILIDTGATMSVLNPTAFPSPLSQSDQKV
SIVGITNHVQSVYLSQPLPFILGEVKDRHSFLLSSDAALHLLGRDFLDKYKATIEFSPGK
EIRLSLSPLEAPPTFQILTAPIIAYDLPQLEEVPSSLWAADSSDIGRILSATPIQVQLDP
SKPLPRIPQYPLSREVTEGIRPLIDSYLEAGILIKCSSPCNSPILGVRKPGGQGWRLVQD
LRAVNACVIPRAPVVPNPHNLLNKIPHSAKIFTVVDLCSAYFSVPLHADRQFLFAFTWEG
IQLCWIVLPQGYTESATYFSQVLKADLAGLKFPFGSTLLQYVDDLLLCSPDAQSSREDLI
VLLKSLAQKGHKVSQEKMQCVSSQVKFLGHLISAEGRSLDPTRVAAILNFPRPKTKRQLQ
GFMGLAGYCRLWVPSFSLVAKPLFDLKASSPEPLIWNKAAKTAFTDLKSALSSSPALGRP
NYSLPFHLFLLERTRISLGVLSQKHGDHFRPLGYYSKSLDSVTRGLPSCLRAVVAASDLL
EPAEEVTLESPLTLHVPHAIEVLWNSHHTQHFSTSRLAKLEASLLATSNITISRCKTLNP
ATFLPDIEESDRDCTEGHDCVNTVDSVLSPREDLQEKELENPDFSWYTDGSCLRNESGIL
VAGYAITTTAEVIEAGHLPSAISAQQADLEAVTRACELAKGKRVNIYTDSRYAFGVAHDF
GMLWQHRGYLTSSGTPIKNGAQVRRLLEALLLPEAIAIIKIPGHSRENSPHAKGNALADQ
YAKEAARQLPATIGLTLSDKEEPIFENKLIQAEIVSAQEIMSRAIQEKLEKEGCVRNRDT
GLWQGPNGCVVLPDPLFHPMMEYLHSISHWGPDKLVSIARKYWWGRLRRAAEDVFALNII
SASL
Download sequence
Identical sequences K7DZM9
ENSMODP00000038980 ENSMODP00000038980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]