SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038982 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038982
Domain Number 1 Region: 124-546
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.45e-118
Family Reverse transcriptase 0.0000000461
Further Details:      
 
Domain Number 2 Region: 598-663
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000024
Family Ribonuclease H 0.0079
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Acid proteases 0.000000488
Family Retroviral protease (retropepsin) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038982   Gene: ENSMODG00000027501   Transcript: ENSMODT00000042091
Sequence length 691
Comment pep:novel chromosome:BROADO5:4:405385478:405390517:-1 gene:ENSMODG00000027501 transcript:ENSMODT00000042091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLNPTAFPSPLPRSDQKVSIVGITNHVQSVYLSQPLPFILGEVKDMHSFLLSSDAPLH
LLGRDFLDKYKATIEFSPGKEIRLSLSPSDAPPTFQILTAPIIAYDLPQLEEVPSSLWAT
DSSDIGRILSAPPIQVQLDPSKPLPRVPQYPLSREATEGIRPLIDSYLEAGILIKCTSPC
NSPILGVRKPGGRGWRLVQDLRAVNACVIPRAPVVPNPHNLLNQILHSAKIFTVVDLCSA
YFSVPLHADSQFLFAFTWEGIQLCWTVLPQGYTESATYFSQVLKADLAGLKFPFGSTLLQ
YVDDLLLCSPDAQSSREDSIVLLKSLAQKGHKVSKEKMQFVSSQVKFLGHLISAEGRSLD
PARVAAILNFPRPKTKRQLRGFMGLAGYCRLWVPSFSLVAKPLFDLLKASSPEPLIWNEA
AKIAFMDLKSALSSSPALGRPNYSLPFHLFLLERNGISLGVLSQKHGDHFRPLGYYSKSL
DSVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHAIEVLLNSHHTQHFSTSRLAK
LEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNIVDSVLSPREDLQEKEL
ENPDFSWYTDGSCLRNESGILVAGYAITTTAEVIEAGHLPSATSAQQAELEAVTRACELA
KGKRFSLAAARKLTDTKGGACQRTEVCQRGG
Download sequence
Identical sequences K7DZN1
ENSMODP00000038982 ENSMODP00000038982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]