SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038990 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038990
Domain Number 1 Region: 129-242
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.88e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038990
Domain Number - Region: 377-405
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00019
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 
Domain Number - Region: 252-310
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.022
Family Retrovirus capsid protein C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038990   Gene: ENSMODG00000029115   Transcript: ENSMODT00000042099
Sequence length 410
Comment pep:novel chromosome:BROADO5:2:244149182:244150452:-1 gene:ENSMODG00000029115 transcript:ENSMODT00000042099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAQLEDLKCFLQDQWANTHSTRNRPVSEPLNEEISFPEIEMENTFPIAQLTDCFSHVVQ
ILSEFNPQNPSPAIPVSHVPSPTENQIPTQRRSCPPRETCPCQTDPQVQNSTRGLFPLRE
VPEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLVTKKMGDIFFQYNPSYKDVE
NLLQAFLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNNPEDYLQLYRCREAILTAMK
EYADSTDKWMELEKIKQKEEESPSRFMDRIIEFGDRYLDWDLTKESSLRQVRRIFVNNSC
KAIKNYFRTQCPRWSDMDLEELRKTAIYVLKGNKEKEEENNDDMEEMKKKMRYLIDRMTK
LESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMKCRTFLKMIGRNTQ
Download sequence
Identical sequences K7DZN9
ENSMODP00000038990 ENSMODP00000038990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]