SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038996 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038996
Domain Number 1 Region: 139-169
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000398
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038996
Domain Number - Region: 14-71
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.017
Family Retrovirus capsid protein C-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 170-229
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0324
Family HNH-motif 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038996   Gene: ENSMODG00000029556   Transcript: ENSMODT00000042105
Sequence length 251
Comment pep:novel chromosome:BROADO5:5:26160585:26161720:-1 gene:ENSMODG00000029556 transcript:ENSMODT00000042105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKECADNTDKWMELEKIKQKAEETPSRFMDRIIEFGDRYLDWDLTKESSIRQVRRIFVNN
SCKAIKNYFKTQCPRWSDMDLEELRKTAIYVLKGNEEKEIENNDDMEEMKKKMKYLIDRI
TKLESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMECRTFLKMFGRNTQFNNSFRNN
NYNEYRNKNFRNQNYRNRNWEINDNAQIEENFNDNTQQYMRNGARPKTTRGTNDPQRGAL
QGGAQGISQKQ
Download sequence
Identical sequences K7DZP5
ENSMODP00000038996 ENSMODP00000038996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]