SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038999 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038999
Domain Number 1 Region: 250-409
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.73e-40
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 2 Region: 4-132
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-22
Family Ribonuclease H 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038999   Gene: ENSMODG00000029610   Transcript: ENSMODT00000042108
Sequence length 521
Comment pep:novel chromosome:BROADO5:2:81965251:81967003:-1 gene:ENSMODG00000029610 transcript:ENSMODT00000042108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAF
GICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRG
NDRADAAAKLAAIEGPGLILTLTTTDNLNLSFSYNEKEVEKWKQKFKAKQINGVWVSPEG
KPLLPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQH
AYRGKAFGGRPLAYTPFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAFPTTRATADFV
AKILLKEIIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMN
KELKTMIGKLCTETHLKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAY
TSLLGGDITIASYIQELQHKLRELHESGAAVQAGPLDFSLHDLNPGDKVYIKNFKRTGAT
EPSWEGPFQILLTTPTSIKIGERDSWIHCSHVKKASSAKTD
Download sequence
Identical sequences K7DZP8
ENSMODP00000038999 ENSMODP00000038999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]