SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039002 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039002
Domain Number 1 Region: 48-122
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-18
Family Splicing factor U2AF subunits 0.00000597
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039002
Domain Number - Region: 122-145
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000432
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039002   Gene: ENSMODG00000029158   Transcript: ENSMODT00000042111
Sequence length 220
Comment pep:novel chromosome:BROADO5:4:9420326:9444935:-1 gene:ENSMODG00000029158 transcript:ENSMODT00000042111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METDVLGCTINQPLARPLPLLNIYRNPQNSFQSADGWRCAVSDVEMQEHYDEFFEEVFTE
MEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVT
DFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRD
RGRGGGGGGGGGGGGGGGGGGGGRERDRRRSRDRERSGRF
Download sequence
Identical sequences K7DZQ1
ENSMODP00000039002 ENSMODP00000039002 XP_007493262.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]