SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039051 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039051
Domain Number 1 Region: 285-438
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-39
Family Retroviral integrase, catalytic domain 0.0017
Further Details:      
 
Domain Number 2 Region: 20-162
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.36e-26
Family Ribonuclease H 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039051   Gene: ENSMODG00000029366   Transcript: ENSMODT00000042162
Sequence length 537
Comment pep:novel chromosome:BROADO5:Un:83259498:83261228:-1 gene:ENSMODG00000029366 transcript:ENSMODT00000042162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISA
QGAELIALKQACIIAKDKKATIYMDSRYSFGICHSVGMLWLQRGFLTSAGKSIANAEIIN
EVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPELILTLTTTNDLNL
PLSYNEKEVEKWKQKFKAKQINGVSVSSEGKPLLPRSFYNQICQSIHKNGHFGTQGIVDS
VKRVWIAPGITTIASKVCSACSICQAYNQHAYRGKAFGGRPLAYTPFEHLQIDFVMMPCY
KFCLVIVDQLTRWPEAFPTTQATADFVAKILLKEIIPHFGLPARIDSDRGSHFTDSVLNQ
IYSFLGITPKFHVPYHPQSSGQVERMNKEFKTMIGKLCTETHLKWPEILPLALFYLRSRP
RGYLHVSPFEMLFGHPPIQAKPFSPAYTSLLGGDITIASYIQELQHKLRELHESGAAVQS
GPLDFSLHDLNPGDKVYIKNFKQTGATQPSWEGPFQILLTTPTSIKIGERDSWIHCS
Download sequence
Identical sequences K7DZV0
ENSMODP00000039051 ENSMODP00000039051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]