SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039142 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039142
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily SET domain 0.0000343
Family Viral histone H3 Lysine 27 Methyltransferase 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039142   Gene: ENSMODG00000029795   Transcript: ENSMODT00000042251
Sequence length 67
Comment pep:novel chromosome:BROADO5:2:140798425:140807869:1 gene:ENSMODG00000029795 transcript:ENSMODT00000042251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPKLEKFWSPSRGNGLRALASLRPGELLFRSEPLAYTVCKESLGVVCERCLCRGRVWR
RRCRRWI
Download sequence
Identical sequences K7E041
ENSMODP00000039142 ENSMODP00000039142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]