SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039149 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039149
Domain Number 1 Region: 125-202
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000405
Family Ribonuclease H 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039149
Domain Number - Region: 2-73
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0125
Family Reverse transcriptase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039149   Gene: ENSMODG00000027833   Transcript: ENSMODT00000042259
Sequence length 207
Comment pep:novel chromosome:BROADO5:Un:102065192:102068515:1 gene:ENSMODG00000027833 transcript:ENSMODT00000042259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYYSKSLDSVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHAIEVLLNSHHTQHF
STSRLAKLEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNIVDSVLSPRE
DLQEKELENPDFSWYTDGSCLRNESGILVAGYAITTTAEVIEAGHLPSATSAQQAELEAV
TRACELAKGKRVNIYTDSSFLLQQQGS
Download sequence
Identical sequences K7E048
ENSMODP00000039149 ENSMODP00000039149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]