SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039164 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039164
Domain Number 1 Region: 278-435
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.9e-39
Family Retroviral integrase, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 18-160
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-26
Family Ribonuclease H 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039164   Gene: ENSMODG00000029071   Transcript: ENSMODT00000042274
Sequence length 549
Comment pep:novel chromosome:BROADO5:1:174055976:174057699:1 gene:ENSMODG00000029071 transcript:ENSMODT00000042274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPRDNLLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQG
AELIALKQACIIAKDKKATIYMDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEV
LSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTTTDNLNLSL
SYNEKEVEKWKQKFKAKQINGIWVSSEGKPLLPRSFYNQICQSIHKNGHFGTQGIVDSVK
RVWIAPGITTVASKVCSACPTCQAYNQHAFRGKAFGGRPLAYTPFEHLQIDFIMMPKAGR
YKFCLVIVDQLTRWPEAFPTTRATADFVAKILLKEIIPRFGLPARIDSDRGSHFTDSVLN
QIYSCLGITPKFHVPYHPQSSGQVERMSKELKTMIGKLCTETHLKWPEILPLALFYLRSR
PRGDLHISPFEMLFGHSPIQAKPFSPAYTSLLGGDITIASYIQELQHKLRELHESGAAVQ
AGPLDFSLHDLNPGDKVYIKSFKRTGATQPSWEGPFQILLTTPTSIKIGERDSWIHCSHV
KKASSVETD
Download sequence
Identical sequences K7E063
ENSMODP00000039164 ENSMODP00000039164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]