SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039173 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039173
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-22
Family Canonical RBD 0.00000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039173   Gene: ENSMODG00000028046   Transcript: ENSMODT00000042283
Sequence length 149
Comment pep:novel chromosome:BROADO5:3:494741486:494744145:-1 gene:ENSMODG00000028046 transcript:ENSMODT00000042283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDHRYGDGGSTFQRTTDHCVHMRGLPYRVTENDIYNFFSPFNPVREHIEIGPDGRVTGE
VDVEFATHEDAVAAMSKDKANMQHRYVKLFLNSTAGASSGAYANQSSYGGPASQQLSGGY
GGGYGGQSSMSGYDQVLQENSSDFQSNIA
Download sequence
Identical sequences K7E072
ENSMODP00000039173 ENSMODP00000039173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]