SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039175 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039175
Domain Number 1 Region: 17-120
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.85e-22
Family Canonical RBD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039175   Gene: ENSMODG00000014730   Transcript: ENSMODT00000042285
Sequence length 313
Comment pep:novel chromosome:BROADO5:8:276637036:276657634:-1 gene:ENSMODG00000014730 transcript:ENSMODT00000042285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAANPETPNSTISREASTQSSSATASQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFF
ARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC
AYHVQPRPLVFNPPPAPQFHSVWSNPNTETYMQPPAMMNPITQYVQFFIVKTILLAEEDG
SKIRAYPPYPNSPVQLITGYQLPIYNYQVPPQWPAGEQRSYVIPPAYTAVNYHCSEVDPG
AEVLQTECSVHEVTQSSGNGQQKKSVDRSIQTVVSCLFNPETRLRNALVTQDDYFKDKRV
HHFRRSRAVLKSV
Download sequence
Identical sequences K7E074
XP_016281935.1.35504 ENSMODP00000018415 ENSMODP00000039175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]