SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039207 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039207
Domain Number 1 Region: 12-436
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.23e-114
Family Reverse transcriptase 0.0000000142
Further Details:      
 
Domain Number 2 Region: 490-632
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.92e-27
Family Ribonuclease H 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039207   Gene: ENSMODG00000027664   Transcript: ENSMODT00000042317
Sequence length 751
Comment pep:novel chromosome:BROADO5:4:57774097:57776351:-1 gene:ENSMODG00000027664 transcript:ENSMODT00000042317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLWATSSSDVGLLKSAVPVQIKTKSSPPPSIPQYPLSKEAIEGITPVINSLIEQGIIIP
CKSEYNTPILPIKKPKKGPDGKHIYRFIQDLRAVNNHVIKRHSVVSNIHTIISSIPSTAT
YFTVVDLCSAFFSIPIHENSRHIFAFTWKGSQYTWCRLPQGYVESPSLFEQILSQDTDNI
TFKNSKLIKYVDDLLLASTDAKTCQEDSKHLLLELHKRGHKISKDKVQWCLPKVEYLGFI
LTAGARSISPKRIENIQKLSAPTTKKQLRAILGATGFCRQWIPCYGEITKPLIALTRDVV
PEPLKLEPEHLSALSELKKAILSAPALGIPNYNKPFTLYVHERRGVASGVLTQTLGPSQR
PITYYSAQLDPVAAGAPPCLRGVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQ
AFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDN
LLDTPLDNADLILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKH
ACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPK
ALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVE
KWKQKFKAKQINGVWVSSEGKPLLPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGI
TTIASKVCSSCSTCQAYNQHAFRGKAFGGRP
Download sequence
Identical sequences K7E0A6
ENSMODP00000039207 ENSMODP00000039207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]