SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039233 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039233
Domain Number 1 Region: 20-442
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.23e-117
Family Reverse transcriptase 0.0000000477
Further Details:      
 
Domain Number 2 Region: 494-572
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000696
Family Ribonuclease H 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039233   Gene: ENSMODG00000029194   Transcript: ENSMODT00000042343
Sequence length 576
Comment pep:novel chromosome:BROADO5:X:25370846:25374460:-1 gene:ENSMODG00000029194 transcript:ENSMODT00000042343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFHSWREVPSSLWATDSSDIGRILSAPPIHVQLDPSKPLPRVPQYPLSREATEGIRPLI
DNYLEAGILIKCTSPCNSPILGVRKPGGRGWRLVQDLRAVNACVIPRAPVVPNPHNLLNK
IPHSAKIFTVVDLCSAYFSVPLHADSQFLFAFTWEGIQLCWTVLLQGYTESATYYSQVLK
ADLAGLKFPFGSTLLQYVDDLLLCSPDAQSSREDSIVLLKSLAQKGHKVSKEKMQFVSSQ
VKFLGHLISAEGRSLDPARVAAILNFPRPKTKRQLRGFMGLAGYCRLWVPSFSLVAKPLF
DLLKASSPEPLIWNEAAKIAFMDLKSALSSSPALGRPNYSLPFHLFLLERNGISLGVLSQ
KHGDHFRPLGYYSKSLDPVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHVIEVL
LNSHHTQHFSTSHLAKLEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNI
VDSVLSPREDLQEKELENPDFSWYTDGSCLRNESGILVAGYAITTTAEVIEAGHLPSAIS
AQQAELEAVTRACELAKGKRINIYMDSRFLLQQQGS
Download sequence
Identical sequences K7E0D2
ENSMODP00000039233 ENSMODP00000039233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]