SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039234 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039234
Domain Number 1 Region: 169-311
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.16e-27
Family Ribonuclease H 0.0032
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.22e-18
Family Reverse transcriptase 0.0000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039234   Gene: ENSMODG00000029377   Transcript: ENSMODT00000042344
Sequence length 436
Comment pep:novel chromosome:BROADO5:3:395060125:395062046:1 gene:ENSMODG00000029377 transcript:ENSMODT00000042344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGAPPCLR
GVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQPFSDERITRYEITLLNSENIT
LKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLENADLILFTDGSSFM
RDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFG
ICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGN
DRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGK
PLLPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHA
YRGKAFGGLPLTYTPF
Download sequence
Identical sequences K7E0D3
ENSMODP00000039234 ENSMODP00000039234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]