SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039249 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039249
Domain Number 1 Region: 377-799
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.56e-117
Family Reverse transcriptase 0.0000000456
Further Details:      
 
Domain Number 2 Region: 851-916
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000329
Family Ribonuclease H 0.0096
Further Details:      
 
Domain Number 3 Region: 164-226
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.0000628
Family Retrovirus capsid protein, N-terminal core domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039249
Domain Number - Region: 47-141
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0314
Family PspA lactotransferrin-binding region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039249   Gene: ENSMODG00000028654   Transcript: ENSMODT00000042359
Sequence length 921
Comment pep:novel chromosome:BROADO5:X:25296272:25302614:-1 gene:ENSMODG00000028654 transcript:ENSMODT00000042359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSKYGPDASKYLEKWQAMTKANPKVSWPRWGSLNEERMLFLQSVLSEAGQEIEGDEREV
FNQWLEEYTQRKHRSERSVEQETGKNKRKVREEEENQGEQGREATKKQIADLQKEVESLK
ELLKGSSNPATSLDSIPEPLESPEAPIPQFPFKIKGREGTKTMQVSFTPWTKTELRAMAK
EFPKARENPIEFAKEFELTLSTYQPGLSDLYQLAHILVGSGDAAHWFKTASWENPLEYIN
QLMARKEGPEVHLQEAKKMGEALLEAIPKAFPKSVNWGKIQTCTQKEGESVFDFYNRFLD
TFRANSGLSPDSPDTLITFNTLYVEGLNKALANLLKRGKVDWNLTPTFQILTAPIIAYDL
PQLEEVPSSLWATDSSDIGRILSAPPIQVQLDPSKPLPRVPQYPLSREATEGIRPLIDNY
LEAGILIKCTSPCNSPILGVRKPGGRGWRLVQDLRAVNACVIPRAPVVPNPHNLLNQIPH
SAKIFTVVDLCSAYFSVPLHADSQFLFAFTWEGIQLCWTVLLQGYTESATYFSQVLKADL
AGLKFPFGSTLLQYVDDLLLCSPDAQSSREDSIVLLKSLAQKGHKVSKEKMQFVSSQVKF
LGHLISAEGRSLDPARVAAILNFPRPKTKRQLRGFMGLAGYCRLWVPSFSLVAKPLFDLL
KASSPEPLIWNEAAKIAFMDLKSALSSSPALGRPNYSLPFHLFLLERNGISLGVLSQKHG
DHFRPLGYYSKSLDSVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHAIEVLLNS
HHTQHFSTSRLAKLEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNIVDS
VLSPREDLQEKELENPDFSWYTDGSCLRNESGILVAGYAITTTAEVIEAGHLPSAISAQQ
AELEAVTRACELAKGKRQQGS
Download sequence
Identical sequences K7E0E8
ENSMODP00000039249 ENSMODP00000039249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]