SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039257 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039257
Domain Number 1 Region: 144-229
Classification Level Classification E-value
Superfamily EF-hand 3.06e-33
Family EF-hand modules in multidomain proteins 0.00016
Further Details:      
 
Domain Number 2 Region: 16-143
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 6.15e-31
Family N-terminal domain of cbl (N-cbl) 0.00025
Further Details:      
 
Domain Number 3 Region: 230-285
Classification Level Classification E-value
Superfamily SH2 domain 2.9e-25
Family SH2 domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039257   Gene: ENSMODG00000027898   Transcript: ENSMODT00000042367
Sequence length 295
Comment pep:known_by_projection chromosome:BROADO5:4:370688564:370693510:1 gene:ENSMODG00000027898 transcript:ENSMODT00000042367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGWPGLPWGARKEQKSLARAIRALEHLEHALGQDPHLEPSPPSLADLLPQMRGLLRQ
VAEAQRLAQGGLHEPGGASDFLAGYLSNLAQKGQQLAALFPAGSKAFWEGSSRRRKLTKL
SLIFSHMHTELRALFPDGHYCGHTYQLSKPQAQEFWRENCGKRCVVPWEEFEALLSSCHP
VKPGPMGQALKSTIDLTVSGHVSVFEFEVFTCLFQPWSSLLKNWTLLAVTHPGYMAFITY
AEVKARLQTYLDKPGSYIFRMSCTRLGQWAIGQKSEHGQVLQSILLXXXXXXXXX
Download sequence
Identical sequences K7E0F6
ENSMODP00000039257 ENSMODP00000039257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]