SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039282 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039282
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.93e-54
Family Reverse transcriptase 0.00000186
Further Details:      
 
Domain Number 2 Region: 294-385
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000125
Family Ribonuclease H 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039282   Gene: ENSMODG00000028621   Transcript: ENSMODT00000042392
Sequence length 386
Comment pep:novel chromosome:BROADO5:2:82179058:82180216:-1 gene:ENSMODG00000028621 transcript:ENSMODT00000042392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASTDAKTCQEDSKHLLLELHKRGHKISKDKVQWCLPKVEYLGFILTAGARSISPKRIENI
QKLCAPTTKKQLRAILGATGFCRQWIPCYGEITKPLIALTRDVVPEPLKLEPEHLSALSE
LKKAILSAPALGIPNYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLDPVAAGA
PPCLRGVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLN
SENITLKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNADLILFTD
GSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKHACIIAKDKKATIYTDS
RYAFGICHSVGMLWLQRGFLTSAGKS
Download sequence
Identical sequences K7E0I1
ENSMODP00000039282 ENSMODP00000039282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]