SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039291 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039291
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.08e-46
Family Reverse transcriptase 0.000000509
Further Details:      
 
Domain Number 2 Region: 227-289
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000152
Family Ribonuclease H 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039291   Gene: ENSMODG00000028643   Transcript: ENSMODT00000042401
Sequence length 289
Comment pep:novel chromosome:BROADO5:2:254091497:254092635:1 gene:ENSMODG00000028643 transcript:ENSMODT00000042401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQAILSIPTPSSPRQVREFLGSVGYCRLWVPNFAETAKPLYAAAWETSDWVWMENVETA
FQDLRKAMLQAPALALPDPEKPYQLFVDERQGVAKGVLTQKLGPWDRPVAYLSKRLNPVS
AGWPSCLRIIAAVALLVKDADKLTHSQPLLIATSHAIESVLRQPPVSWLSHARLTHYQSL
LLNEARLSFRVVSTLNPATLLPTGDDNTETHSCQEILVESISARPDLKDVPLASPDLIFF
TDGSSFMSPQGRRAGAAVVDHTGQIIWDASPPEGTSAQKAELVALAAAL
Download sequence
Identical sequences K7E0J0
ENSMODP00000039291 ENSMODP00000039291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]