SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039334 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039334
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-36
Family Retroviral integrase, catalytic domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039334   Gene: ENSMODG00000029564   Transcript: ENSMODT00000042444
Sequence length 255
Comment pep:novel chromosome:BROADO5:4:288172291:288173448:1 gene:ENSMODG00000029564 transcript:ENSMODT00000042444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKAGQYKFCLVIVDQLTRWPEAFPTARATAAFVAKVLLKEIIPRFGLPARIDSDRGSHF
TDSVLNQIYSCLGITPKFHVPYHPQSSGQVERMNKELKTMIGKLCTETHLKWPEILPLAL
FYLRSRPRGDLHISPFEMLFGHPPIQAKPFSPAYTSLLGGDTTIASYIQELQHKLRELHE
SGAAVQAGPLDFSLHDLNPGDNVYIKNFQRTGATQPSWEGPFQILLTTPTSIKVGEKDSW
IHCSHVKRASSVETY
Download sequence
Identical sequences K7E0N3
ENSMODP00000039334 ENSMODP00000039334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]