SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039364 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039364
Domain Number - Region: 26-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000114
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039364   Gene: ENSMODG00000027887   Transcript: ENSMODT00000042475
Sequence length 317
Comment pep:novel chromosome:BROADO5:1:228425193:228428190:1 gene:ENSMODG00000027887 transcript:ENSMODT00000042475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQSCNCGPLGVALAAGARRQQKWQSIIIRVQSPEGVKWITATKREKAATFLKKVAKEFGF
QNNGFSVYINRNKIGEITASSPNKSLNLLKIKHGDLLFLFPLSLAGPSSDTETSSTQALR
AWGAPNVVEDEIDQYLSKQDGKIYRNRDPQLCRHGPLGKCVHCVPLEPFDEDYLNYLEPP
VKHMSFHAYIRKLTRGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRK
KYQHVDNIMFENHTVADRFLDFWRKTGIQHFGYLYGQYTEHKDIPLGIRAEVVLSFMKPL
RLVHRTAWSSLKTPKLK
Download sequence
Identical sequences K7E0R3
ENSMODP00000039364 ENSMODP00000039364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]