SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039453 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039453
Domain Number 1 Region: 277-388
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.05e-38
Family Retroviral integrase, catalytic domain 0.00057
Further Details:      
 
Domain Number 2 Region: 68-208
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-18
Family Ribonuclease H 0.0057
Further Details:      
 
Domain Number 3 Region: 217-269
Classification Level Classification E-value
Superfamily N-terminal Zn binding domain of HIV integrase 0.0000000000000183
Family N-terminal Zn binding domain of HIV integrase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039453   Gene: ENSMODG00000028226   Transcript: ENSMODT00000042559
Sequence length 392
Comment pep:novel chromosome:BROADO5:8:6650727:6652228:1 gene:ENSMODG00000028226 transcript:ENSMODT00000042559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGVRLATRHFGRQPDHIVSPYNKEQLRWLQTQNDNWAVLISSYQGTIDNHMPSNKLLQF
FTLTPFTLTRITQSSPIPGAPTIFVDGSKTGLAAIVMHDYPHTVHTPYQSAQLVELYAAL
TVFISLPESPFNLYSDSRYVVQSLLRLEATPVIQPTTATFFLFTKIQQAIRARSHPFFIG
HIRAHSGLPGPLALGNDLADQYTRLAALAVPTIPSPDPISLATEAHKLHHLNAHTLRLAY
KITREQARAIVKSCKNCLTLLPEPHLGVNPRGLLPGHLWQMDVTHVPSFAKLKYVHVSID
TFSGFLFASAQSGEATKHVIKHMFLAMSVMGRPLTLKTDNGPGYASRSFKQFCAQLGIKH
ITGIPYNPQGQGIVERANQTLKNTIFKHKNSG
Download sequence
Identical sequences K7E102
ENSMODP00000039453 ENSMODP00000039453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]