SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039512 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039512
Domain Number 1 Region: 99-241
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-39
Family Ribonuclease H 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039512   Gene: ENSMODG00000028814   Transcript: ENSMODT00000042618
Sequence length 245
Comment pep:novel chromosome:BROADO5:4:243901325:243903554:1 gene:ENSMODG00000028814 transcript:ENSMODT00000042618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATTCSKSHSKQDVYRFKRFSTPDAAWAFVRSASPDHSKEQKKKCEIQIPEVNLERILC
ESSSDEEGEEPCPKIAKRSPDCSESSLNKNTFCYMGDAAVVYTDGCCSSKGKKPRAGIGV
YWGPGHPLNVGDRLTGRQTNQRAEIHAACKALEQAKDQNINKLVLYTYSMCTVNGITNRI
KDWKKNGWKTSAGKKVSNKDDFVKLDRLTRGIDIQWIHVPCHSALEGNEEADKLAREGAK
KSHST
Download sequence
Identical sequences K7E161
ENSMODP00000039512 ENSMODP00000039512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]