SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039515 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039515
Domain Number 1 Region: 124-546
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.89e-118
Family Reverse transcriptase 0.000000041
Further Details:      
 
Domain Number 2 Region: 877-1037
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.12e-39
Family Retroviral integrase, catalytic domain 0.0014
Further Details:      
 
Domain Number 3 Region: 603-750
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-30
Family Ribonuclease H 0.0028
Further Details:      
 
Domain Number 4 Region: 2-79
Classification Level Classification E-value
Superfamily Acid proteases 0.00000203
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039515   Gene: ENSMODG00000027661   Transcript: ENSMODT00000042621
Sequence length 1164
Comment pep:novel chromosome:BROADO5:7:81336983:81340477:1 gene:ENSMODG00000027661 transcript:ENSMODT00000042621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLNPTAFPSPLPRSDQKVSIVGITNHVQSVYLSQPLPFILGEVKDMHSFLLSSGAPLH
LLGRDFLDKYKATIEFSPGKEIRLSLSPSDAPPTFQILTAPIIAYDLPQLEEVPSSLWAT
DSSDIGRILSAPPIQVQLDPSKPLPRVPQYPLSREATEGIRPLIDSYLEAGILIKCTSPC
NSPILGVRKPGGRGWRLVQDLRAVNACVIPRAPVVPNPHNLLNQIPHSAKIFTVVDLCSA
YFSVPLHADSQFLFAFTWEGIQLCWTVLPQGYTESATYFSQVLKADLAGLKFPFGSTLLQ
YVDDLLLCSPDAQSSREDSIVLLKSLAQKGHKVSKEKMQFVSSQVKFLGHLISAEGRSLD
PARVAAILNFPRPKTKRQLRGFMGLAGYCRLWVPSFSLVAKPLFDLLKASSPEPLIWNEA
AKIAFMDLKSALSSSPALGRPNYSLPFHLFLLERNGISLGVLSQKHGDHFRPLGYYSKSL
DSVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHAIEVLLNSHHTQHFSTSRLAK
LEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNIVDSVLSPREDLQEKEL
ENPDFSWYTDGSCLRNESGILVARYAITTTAEVIEAGHLPSATSAQQAELEAVTRACELA
KGKRVNIYTDSRYAFGVAHDFGMLWQHRGYLTSSGTPIKNGAQVRRLLEALLLPKAIAII
KIPGHSRENSPHAKGNALADQYAKEAARQVPTTIGLALSDKEEPIFENKLTQAEIVSAQE
VMSRTIQEKLEKEGCVRNRDTGLWQGPNGCVVLPDPLCRPMMEYLHSISHWGPDKLVSIA
RKYWWGRLRRAAEDVYLQCQICPKYNVSKPLKPMPGKFPLPEAPFQVWQIDFIQLPPHAG
YKFVLVMVCMFSRWVEAFPCRQATATAVAKCLLEKIFPVWGIPREIHSDRGTHFTGLVVS
QLLTAWPVLHHLHCAYHPQSSGLVERVNGIIKVQLAKFMEDLNIPWPKALPIVLLNLRAT
PFGKLSLSPFEIITGRPMSLFPPYTDSMSTKVSLLSYCQGLAKTLQGLNHLISQSVSRNS
SSETPSTSKVKPGDWVYRKRHLRKDALQVRWDGPHQVLLVNPSAAKLKGIESWIHLSHLK
KAPTPKWSVKSMSDTKIRLTRRRR
Download sequence
Identical sequences K7E164
ENSMODP00000039515 ENSMODP00000039515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]