SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039546 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039546
Domain Number 1 Region: 143-256
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.73e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039546
Domain Number - Region: 391-420
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000103
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039546   Gene: ENSMODG00000029731   Transcript: ENSMODT00000042652
Sequence length 446
Comment pep:novel chromosome:BROADO5:5:203300969:203302430:-1 gene:ENSMODG00000029731 transcript:ENSMODT00000042652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMEHKIGKIEDKMQAQLEDLKCFLQDQWANTHSTRNRPVSEPLNEEISFPEIEMENTF
PIAQLTDCFSRAVQILSEFNPQNPSPAIPASHVPSPTENQIPMQGRSCPPRETCPCQTDP
QVQNSTRGLFPLREVPEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLVTKKMG
DIFFQYNPSYKDVESLLQAFLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNNPEDYL
QLYRCREAILTAMKECADSTDKWMELEKIKQKENETPSRFMDRIIEFGDRYLDWDLNKEN
SLRQVRRIFVNNSCKVIKNYFKTQCPRWSDMDLEELRKTAIYVFKGNEEKEKENNDDMEE
MKKKMRCVIDRITKLESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMECRTFLKMFG
RNTQFNNGFRNNNYRNYDNGYRNQNS
Download sequence
Identical sequences K7E195
ENSMODP00000039546 ENSMODP00000039546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]