SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039593
Domain Number - Region: 110-141
Classification Level Classification E-value
Superfamily UBA-like 0.0166
Family CUE domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039593   Gene: ENSMODG00000028758   Transcript: ENSMODT00000042699
Sequence length 143
Comment pep:novel chromosome:BROADO5:8:206123542:206154674:-1 gene:ENSMODG00000028758 transcript:ENSMODT00000042699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLLIHVEDIAGQKVLRNFQNIQKSKNILFVISKPDVFKSPALNICFIFGEAKMEDLSQ
QVHKAAAEKFKVPVELSPIITETVPDLRAKEESDEEEEVDETGLEVRDFELVMAQANVSR
AKAVRALRHNNNDIVNAIMELTM
Download sequence
Identical sequences K7E1E2
ENSMODP00000039593 ENSMODP00000039593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]