SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039628 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039628
Domain Number 1 Region: 4-144,173-243
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.07e-43
Family DnaQ-like 3'-5' exonuclease 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039628   Gene: ENSMODG00000028091   Transcript: ENSMODT00000042734
Sequence length 536
Comment pep:novel chromosome:BROADO5:1:470052667:470248724:1 gene:ENSMODG00000028091 transcript:ENSMODT00000042734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKKNDYYYQLPIARERIHFLHTWEEVDKCRDVILQPGQVVGIDMEWRPSFGLVGRPRVS
VLQIATKEHVYLLDLLQFSKLDKEEKEKELCHFIWSLFSEPSITKLGYGMSGDLCSLSTT
YPALREMEKQAQGILDLLQVDKQLQKNSGLWKKHHIPVDSLCQEPSSKTKRTRHAEKGLS
LLVQNLLGKPLDKREQLSNWEKRPLREEQILYAASDAYCLLEVYEVLCKDPANFGLTANL
KECLAGKQSTKPRAEKQLSKQGTQSPSKQVLASAGEMLYASAFPEISAKDFSVVCDTMLQ
GLARYLRCLGVDVHVLENTDDHRKAAEIARKEGRIILTSGLPYQKLQAQVGEGRCFSVNC
SDKAKQQALSVLKHFNVRVTLTDIFSRCQVCNCDKYLKISKEKIRHLMKISGYLSEEDNA
GCPKSPEEEWELYPKAESPALSETKQFPGCAYNPNCRWLGDSDLNAGSLTLKNGTTLQIR
TIPLGVLEKTNLSHFYCCTQCGKVFWEGSHFGRVVSQFQEILEGSEPQSQSFYELN
Download sequence
Identical sequences K7E1H7
ENSMODP00000039628 ENSMODP00000039628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]