SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039642 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039642
Domain Number 1 Region: 134-200
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000785
Family Canonical RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039642   Gene: ENSMODG00000027913   Transcript: ENSMODT00000042748
Sequence length 224
Comment pep:known_by_projection chromosome:BROADO5:3:341800059:341834108:-1 gene:ENSMODG00000027913 transcript:ENSMODT00000042748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTIPEDIRAILKLPPLTMYQKGKTVNRTQDIRSTFERISKLHRLLPDPLRDVLCSFTSE
EDLRENNEFPVFEKILKVKKLPNEIYKITAPNHMPFWRRYMSNKIFEANREFIFRKRPLQ
GIIMSAVVVRWLERNLRPSLTQEMVTEVLLVFGPIESVTSMGQRSALIIFENIISASRAV
SAFPHDGILNRIKCIWFYKYMAKDRKYKCGGKRVVIKIEDVNPQ
Download sequence
Identical sequences K7E1J1
ENSMODP00000039642 ENSMODP00000039642 XP_007488082.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]