SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039730 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039730
Domain Number 1 Region: 13-246
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.89e-54
Family Reverse transcriptase 0.00000158
Further Details:      
 
Domain Number 2 Region: 560-719
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-40
Family Retroviral integrase, catalytic domain 0.0013
Further Details:      
 
Domain Number 3 Region: 300-442
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-26
Family Ribonuclease H 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039730   Gene: ENSMODG00000027851   Transcript: ENSMODT00000042835
Sequence length 831
Comment pep:novel chromosome:BROADO5:1:82597196:82600697:1 gene:ENSMODG00000027851 transcript:ENSMODT00000042835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYSWLQQMQKHACQEDSKHLLLELHKRGHKISKDKVQWCLQKVEYLGFILTAGARYISP
KRIENIQKLSAPTTKKQLRAILGATGFCRQWIPCYGEITKPLIALTKDSVPEPLKLEPEH
LSALTDLKKAIMSAPALGIPDYNKPFTLYVHERRGVASGVLTQTLGPSQRPIAYYSAQLD
PVAAGAPPCLRGVAATALLVTKTVDLVLGCPLTIMCPHEIEALLVKHRTQAFSDQRITRY
EITLLNSENITLKRCSTLNPATLLPDLPTSGEPLHNCETLVSMAEKPRDNLLDTPLDNAD
LILFTDGSSFMRDGIRYTGAAVVSEFATEWSASLPSNISAQGAELIALKQACIIAKDKKP
TIYTDSRYAFGICHSVGMLWLQRGFLTSAGKSIANAEIINEVLSALKLPKALAVVHCSAH
TGGSDPVSRGNDRADAAAKLAAIEGPGLILTLTTTDNLNLSLSYNEKEVEKWKQKFKAKQ
INGVWVSPEGKPMVPRSFYNQICQSIHKNGHFGTQGIVDSVKRVWIAPGITTVASKVCSA
CPICQAYNQHAYRGKAFGGRPLAYTPFEHLQIDFITMPKAGRYKFCLVIVDQLTRWPEAF
PMTRATADFVAKILLKEIIPRFGLPARIDSDRGSHFTDSVLNQIYSCLGITPKFHVPYHP
QSSGQVERMNKELKTMIGKLCTETHLKWPEILPLALFYLRSRPRGDLHISPFEMLFGHPP
IQAKPFSPAYTSLLGGDITIASYIQELQHKLRELHESGAAVQAGPLDFSLHDLNPGDKVY
IKNFKRTGATEPSWEGPFQILLTTPTSIKIGERDSWIHCSHVKKASSAETD
Download sequence
Identical sequences K7E1S9
ENSMODP00000039730 ENSMODP00000039730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]